If you have been reading about certificate of analysis and want a single page that covers the useful parts, this is it: definitions, context, how it is studied, and the questions that come up repeatedly.
Last reviewed on 2026-08-01. Where a claim depends on a specific study, the study is described rather than over-claimed.
TB-500 refers to a synthetic peptide fragment derived from the actin-binding region of thymosin beta-4, a protein present in most mammalian cells. The full protein contains forty-three amino acids, while the commonly sold fragment is a much shorter acetylated sequence, often cited as LKKTETQ. The fragment retains part of the actin-binding motif but lacks the remainder of the parent protein. Material sold under this name is usually lyophilized powder intended for laboratory research, and it is not a finished pharmaceutical product.
Proposed activity centers on actin sequestration and on the movement of cells during repair processes. In cell culture and animal models, the fragment has been associated with migration, tube formation, and tissue remodeling. These observations are frequently described as preliminary, because most published work uses rodent or in vitro systems rather than controlled human trials. Whether the short fragment reproduces the effects of the full protein remains an open question, and the relationship between dose, route, and measured outcome is not well characterized.
The compound circulates in the literature as a research reagent rather than an approved therapeutic. Regulatory agencies in several countries have not authorized it for medical use, and sporting bodies list related thymosin beta-4 peptides among prohibited substances. Suppliers typically market it with a purity figure and a certificate of analysis, while peer-reviewed clinical reports remain sparse. Discussions therefore often separate laboratory findings from anecdotal reports, and reviewers tend to note the small size and methodological limits of the available studies.
Dry powder is commonly held at minus twenty degrees Celsius, with some suppliers recommending lower temperatures for long-term archival storage. Once dissolved, solutions are typically kept cold and protected from light, since aqueous peptide solutions can lose integrity through hydrolysis or oxidation over time. Stability data specific to this fragment are limited in the public literature, and much of the guidance comes from general peptide handling practice rather than from controlled degradation studies. Users therefore treat stated shelf lives as approximate rather than fixed.
Identity and purity are normally assessed with reversed-phase high-performance liquid chromatography, paired with mass spectrometry to confirm molecular mass. A certificate of analysis reports a purity percentage, usually derived from chromatographic peak area, but that figure does not by itself prove a correct sequence or the absence of counterions. Independent verification may include amino acid analysis or peptide mapping. Batch-to-batch variation is a documented concern in the research chemical market, and the gap between a quoted purity value and actual peptide content can be substantial when the material is a salt or retains residual water.
| Property | Value | Notes |
|---|---|---|
| Appearance | White to off-white powder | Lyophilized solid as supplied |
| Water solubility | Soluble | Dissolves in aqueous media |
| Typical storage temperature | -20 °C | Dry powder, desiccated, protected from light |
| Typical analytical method | RP-HPLC with mass spectrometry | Purity from peak area; mass for identity |
| Common synonyms | Tβ4 fragment; thymosin beta-4 fragment | Naming varies by supplier and catalogue |
Material sold under this label typically arrives as a freeze-dried powder in a sealed vial with a certificate of analysis. Such certificates usually report reversed-phase chromatography purity plus a mass confirmation, and stated purities commonly sit between 95 and 99 percent. Counter-ion identity, residual trifluoroacetate, water content, and peptide net weight are separate specifications that a certificate may or may not include. A purity figure alone does not establish sequence identity, so independent mass verification remains the practical check.
The designation TB-500 circulates in laboratory and catalog contexts without a single agreed definition. Most product listings apply it to an N-terminally acetylated seven-residue fragment of thymosin beta-4, while other listings attach the same label to the full 43-residue protein. Because the term is commercial rather than systematic, two entries bearing identical names may describe different molecules. Any documentation should therefore state which sequence a given sample is claimed to contain.
The fragment most often associated with the name carries the sequence Ac-LKKTETQ, matching residues 17 through 23 of thymosin beta-4. That region holds the actin-binding motif responsible for much of the parent protein's biochemical activity. Apart from N-terminal acetylation the peptide is unmodified and contains no disulfide bonds, so it shows little ordered secondary structure in solution. Full-length thymosin beta-4 is instead a 43-residue polypeptide of roughly 4.9 kDa found widely across mammalian cell types.
Animal work has examined the peptide in models of cardiac injury, skin wounding, and corneal repair, with reported outcomes covering cell migration, inflammatory cell influx, and tissue remodeling. Several of those experiments used the full-length protein or longer fragments instead of the seven-residue sequence, which makes direct comparison between reports difficult. Results are generally described as tissue-dependent, and effect sizes vary considerably across laboratories. Independent replication is uneven, so the overall picture is incomplete rather than settled.
Controlled human trials of the short fragment are scarce. Much of what appears in review articles is extrapolated from animal models or from studies of the parent protein, and literature searches return a larger body of cardiac and ophthalmic work on thymosin beta-4 than on the abbreviated peptide. Regulatory treatment differs by jurisdiction, and in several countries the material is handled as a research chemical rather than an approved therapeutic. Statements about human benefit should be read as provisional.
Discussion of TB-500 appears in several distinct literatures that rarely cite one another. Peer-reviewed studies usually describe in vitro assays or small animal experiments and are cautious about extrapolation. Veterinary and sports communities circulate anecdotal reports with limited methodological detail. Commercial listings add a third layer, often using the name interchangeably with thymosin beta-4 even though the two molecules differ in size and sequence. Regulatory status varies by country, and the compound is not a licensed medicine in most jurisdictions, so readers comparing sources should check which molecule and which purity each source actually describes.
TB-500 is a synthetic seven-residue peptide whose sequence, LKKTETQ, matches the N-terminal actin-binding region of thymosin beta-4. It is usually supplied in an N-terminally acetylated form, a modification that blocks the free amino terminus and can influence behavior in solution. In the research literature the same sequence appears under several names, including thymosin beta-4 fragment and shortened thymosin beta-4. Because it is a short peptide rather than the full 43-residue parent protein, its measured properties differ from those reported for thymosin beta-4 as a whole, and the two are not interchangeable in experimental design.
Glucagon-like peptide-2 (GLP-2) is a 33 amino acid peptide with the sequence HADGSFSDEMNTILDNLAARDFINWLIQTKITD (see Proteinogenic amino acid) in humans. GLP-2 is created by specific post-translational proteolytic cleavage of proglucagon in a process that also liberates the related glucagon-like peptide-1 (GLP-1). GLP-2 is produced by the intestinal endocrine L cell and by various neurons in the central nervous system. Intestinal GLP-2 is co-secreted along with GLP-1 upon nutrient ingestion. When externally administered, GLP-2 produces a number of effects in humans and rodents, including intestinal growth, enhancement of intestinal function, reduction in bone breakdown and neuroprotection. GLP-2 may act in an endocrine fashion to link intestinal growth and metabolism with nutrient intake. GLP-2 and related analogs (such as Teduglutide) may be treatments for short bowel syndrome, Crohn's disease, osteoporosis and as adjuvant therapy during cancer chemotherapy. GLP-2 has an antidepressant effect in a mouse model of depression when delivered via intracerebroventricular injection. However, a GLP-2 derivative (PAS-CPP-GLP-2) was shown to be efficiently delivered to the brain intranasally, with similar efficacy.
Retiform hemangioendothelioma (hobnail hemangioendothelioma) Schwannoma (acoustic neuroma, neurilemmoma, neurinoma, neurolemmoma, Schwann cell tumor) Solitary angiokeratoma Solitary cutaneous leiomyoma Solitary mastocytoma Solitary neurofibroma (plexiform neurofibroma, solitary nerve sheath tumor, sporadic neurofibroma) Spider angioma (nevus araneus, spider telangiectasia, spider nevus, vascular spider) Spindle cell hemangioendothelioma (spindle cell hemangioma) Spindle cell lipoma Sternal cleft Subungual exostosis Superficial acral fibromyxoma Systemic mastocytosis Targetoid hemosiderotic hemangioma (hobnail hemangioma) Telangiectasia Telangiectasia macularis eruptiva perstans Teratoma Tufted angioma (acquired tufted angioma, angioblastoma, angioblastoma of Nakagawa, hypertrophic hemangioma, progressive capillary hemangioma, tufted hemangioma) Umbilical granuloma Universal angiomatosis (generalized telangiectasia) Urticaria pigmentosa (childhood type of generalized eruption of cutaneous mastocytosis) Venous lake (phlebectasis) Wildervanck syndrome Xanthelasmoidal mastocytosis Zosteriform metastasis
In patients on a vitamin K antagonist such as warfarin with supratherapeutic INR but INR less than 10 and no bleeding, it is enough to lower the dose or omit a dose, monitor the INR and resume the vitamin K antagonist at an adjusted lower dose when the target INR is reached. For people who need rapid reversal of the vitamin K antagonist – such as due to serious bleeding – or who need emergency surgery, the effects of warfarin can be reversed with vitamin K, prothrombin complex concentrate (PCC), or fresh frozen plasma (FFP).
== Tissue distribution == RNA expression charts show highest expression in lung and adipose tissue in humans. Cell types that express the highest levels of CALCRL include oligodendrocyte precursor cells, endothelial cells, lymphatic endothelial cells, adipocytes, endometrial stromal cells, as well as dendritic cells.
Sources: en.wikipedia.org
== Prognosis == With treatment, the majority of people with BPD can find relief from distressing symptoms and achieve remission, defined as a consistent relief from symptoms for at least two years. Remission rates are about 50–70% over five years. The remission rate is estimated to be around 50% at ten years, with 93% of people being able to achieve a two-year remission and 86% achieving at least a four-year remission, with a 30% risk of relapse over 10 years. Patient personality can play an important role during the therapeutic process, leading to better clinical outcomes. Recent research has shown that BPD patients undergoing dialectical behavior therapy (DBT) exhibit better clinical outcomes correlated with higher levels of the trait of agreeableness in the patient, compared to patients either low in agreeableness or not being treated with DBT. This association was mediated through the strength of a working alliance between patient and therapist; that is, more agreeable patients developed stronger working alliances with their therapists, which, in turn, led to better clinical outcomes. In addition to recovering from distressing symptoms, people with BPD can also achieve high levels of psychosocial functioning. A longitudinal study tracking the social and work abilities of participants with BPD found that six years after diagnosis, 56% of participants had good function in work and social environments, compared to 26% of participants when they were first diagnosed. Vocational achievement was generally more limited, even compared to those with other personality disorders.
== 1942: Battle of Stalingrad == On 1 January 1942, the 4th Panzer Group was redesignated 4th Panzer Army. The 4th Panzer Army held defensive positions in the spring of 1942 and then was reinforced, re-fit and transferred to Army Group South for Case Blue, its offensive in Southern Russia. Command was transferred to general Hermann Hoth in June. As the operation progressed, Hitler divided Army Group South into two army groups. Army Group A which was composed of the German 17th Army and 1st Panzer Army and Army Group B which was composed of 6th Army and the 4th Panzer Army. The 4th Panzer Army was on 1 Aug 1942 composed of:
An examination using human cells in-vitro displayed gingerols capabilities in combating oxidative stress. The results concluded that gingerol had anti-inflammatory effects though shogaol showed the most promising effects combating free radicals. There was an inverted dose- concentration response and as dosage concentration increased the amount of free radicals in cells decreased. Cisplatin is a chemotherapy drug that if used in high dosages causes renal failure which is considered a limiting factor for this life saving drug. By using [6]-gingerol it prevented the occurrence of renal failure in rats. [6]-gingerol improved glutathione production in dose-dependent results which suggested that the higher a dosage the more of an effect [6]-gingerol had. Gingerol compounds are thought to help in diabetic patients because of increases in glutathione, a cellular toxin regulatory factor. Anti-hyperglycaemic effects were studied in diabetic and severely obese mice. Gingerol compounds increased glucose uptake in cells without the need of a synthetic insulin activator, while also decreasing fasting glucose and increasing glucose tolerance. In a different study the exact metabolic mechanisms associated with the physiological benefits of gingerol phytochemicals concluded that there was increased enzyme activity (CAT) and glutathione production while decreasing lipoprotein cholesterol and improving glucose tolerance in mice.
National Commission on Terrorist Attacks Upon the United States—Official commission website List of victims September 11, 2001, Documentary Project from the U.S. Library of Congress, Memory.loc.gov September 11, 2001, Web Archive from the U.S. Library of Congress The September 11th Sourcebooks at The National Security Archive September 11 Digital Archive: Saving the Histories of September 11, 2001, from the Center for History and New Media and the American Social History Project/Center for Media and Learning The 9/11 Legacies Project, Oriental Institute, Czech Academy of Sciences, Prague 9/11 at 20: A Week of Reflection; Archived April 16, 2022, at the Wayback Machine, Quincy Institute for Responsible Statecraft September 11, 2001 collection at the Smithsonian National Museum of American History Multimedia
Cyclodipeptide synthases (CDPSs) are a newly defined family of peptide-bond forming enzymes that are responsible for the ribosome-independent biosynthesis of various cyclodipeptides, which are the precursors of many natural products with important biological activities. As a substrate for this synthesis, CDPSs use two amino acids activated as aminoacyl-tRNAs (aa-tRNAs), therefore diverting them from the ribosomal machinery. The first member of this family was identified in 2002 during the characterization of the albonoursin biosynthetic pathway in Streptomyces noursei. CDPSs are present in bacteria, fungi, and animal cells.
Sources: en.wikipedia.org
TB-500 is a name used for a short synthetic peptide fragment taken from the actin-binding region of thymosin beta-4. Material sold under this label is usually a lyophilized powder supplied for laboratory research rather than a licensed medicine. The commonly cited sequence is LKKTETQ.
The parent protein contains forty-three amino acids, while the fragment carries only a short motif from one region. The fragment can interact with actin in vitro, but it does not include the rest of the protein structure. Whether the shorter molecule behaves the same way in living systems is not settled.
Published controlled human studies are scarce, and most activity reports come from cell culture or animal models. Reviews often describe the evidence base as limited and methodologically uneven. Open questions include the relationship between route, dose, and measured outcomes.
Dry lyophilized powder is usually kept frozen, desiccated, and out of direct light. Sealed vials are not opened until needed, because moisture uptake can degrade short peptides. Longer archival storage is often done at lower temperatures than routine working stock.