This is a working overview of synthetic peptide, written for readers who want more than a one-paragraph summary but less than a textbook.
Reviewed 2026-05-07. Anything still debated is marked as such rather than presented as settled.
The regulatory position is broadly consistent across major jurisdictions: no thymosin beta-4 fragment is an approved medicine, and laboratory material is commonly labelled as not intended for human consumption. Anti-doping rules in sport list thymosin beta-4 and its fragments among prohibited peptide hormones. Because these products travel through research-chemical channels rather than pharmaceutical supply chains, quality varies considerably between vendors. Independent testing of identity, purity and sterility is the only dependable check, and a certificate of analysis describes one batch rather than a supplier's whole catalogue.
Lyophilized peptide powder is normally held desiccated at −20 °C, with −80 °C used for longer storage periods. Allowing a sealed vial to reach room temperature before opening is standard practice, because condensation forming on cold powder introduces moisture. Once dissolved, solutions are typically kept cold and shielded from light. Repeated freeze-thaw cycles are avoided because they encourage aggregation and gradual loss of material. These conventions are general to synthetic peptides rather than unique to any one sequence.
Purity and identity are separate measurements and are often confused. Reverse-phase high-performance liquid chromatography, usually with ultraviolet detection near 214 nanometres, reports the share of total peak area belonging to the target compound. Mass spectrometry by electrospray or matrix-assisted laser desorption then checks whether the observed mass matches the expected sequence. Neither measurement alone shows that a vial holds the intended peptide. Peptide content, meaning the fraction of vial mass that is genuine peptide rather than counter-ion, water or residual acid, is reported separately and is frequently lower than the stated purity figure.
Published work involving this sequence spans actin-binding assays, cell-migration studies, wound-healing models, and cardiovascular or musculoskeletal experiments. Much of the biological rationale derives from in vitro systems and animal models, and the number of controlled human studies is small. Reported outcomes vary across preparations, doses, and routes, which complicates comparison between studies. Reviews generally describe the evidence base as preliminary rather than settled. Mechanistic explanations are often proposed by analogy to the parent protein rather than demonstrated directly.
TB-500 is a synthetic seven-amino-acid peptide with the sequence LKKTETQ, corresponding to residues 17 through 23 of the protein thymosin beta-4. The N-terminus is typically acetylated in the described form, giving a monoisotopic mass near 888.5 Da and an average mass of about 889 Da. The designation TB-500 is a catalogue label rather than a formal chemical name, and the same sequence appears in the literature under several alternative abbreviations. It is handled as a research reagent rather than a pharmaceutical product.
| Property | Value | Notes |
|---|---|---|
| Dosage form | Lyophilized powder in sealed vial | Reconstituted before analytical or laboratory use |
| Reconstitution solvent | Sterile or bacteriostatic water | Bacteriostatic water limits microbial growth in multi-use vials |
| Typical working pH | Near neutral, buffered | Strongly acidic or basic conditions promote degradation |
| Stability indicator | Loss of main HPLC peak over time | Aggregation and oxidation are common degradation routes |
| Documentation | Batch certificate of analysis | Covers identity, purity and sometimes sterility testing |
Controlled human trials of the short fragment are scarce. Much of what appears in review articles is extrapolated from animal models or from studies of the parent protein, and literature searches return a larger body of cardiac and ophthalmic work on thymosin beta-4 than on the abbreviated peptide. Regulatory treatment differs by jurisdiction, and in several countries the material is handled as a research chemical rather than an approved therapeutic. Statements about human benefit should be read as provisional.
Biological interest in this peptide centers on its relationship to actin dynamics. Thymosin beta-4 binds monomeric actin through an LKKTET motif, and a short sequence carrying that motif can compete with other actin-binding proteins in cell-free preparations. Investigators propose that such competition shifts the balance between filament assembly and disassembly, which in turn affects how readily a cell extends protrusions and migrates. Most of the supporting observations come from cultured cells and purified protein systems rather than from intact organisms.
Animal work has examined the peptide in models of cardiac injury, skin wounding, and corneal repair, with reported outcomes covering cell migration, inflammatory cell influx, and tissue remodeling. Several of those experiments used the full-length protein or longer fragments instead of the seven-residue sequence, which makes direct comparison between reports difficult. Results are generally described as tissue-dependent, and effect sizes vary considerably across laboratories. Independent replication is uneven, so the overall picture is incomplete rather than settled.
Full-length thymosin beta-4 consists of roughly forty-three amino acids and ranks among the more abundant small proteins in the cytoplasm. The fragment is much shorter, so it cannot reproduce every function attributed to the intact molecule. In cell culture, short actin-binding motifs can interfere with filament dynamics and cell movement, but such observations come from controlled experiments rather than from whole-animal work. Whether a truncated fragment produces the same effects as the parent protein remains an open question.
Interest in the peptide grew during the 2000s and 2010s, when studies of tendon and ligament injuries in horses reported changes in lesion size after treatment. Those reports circulated widely outside the scientific literature and shaped much of the current online discussion. Subsequent reviews noted inconsistent study design, small groups, and a shortage of independent replication. Popular descriptions often blur the line between the fragment, the complete protein, and unrelated growth factors, which complicates comparisons across sources.
TB-500 is a synthetic peptide whose sequence corresponds to a short fragment near the N-terminus of thymosin beta-4, a small protein present in most mammalian cells. The fragment is commonly cited as containing the actin-binding region of the parent molecule, which is why it appears in laboratory work on cell migration and tissue repair. Suppliers distribute it as a lyophilised powder intended for research use. Its identity is defined by amino acid sequence and by the presence of an acetyl group on the N-terminal residue.
Through individualized research projects, trainees gain practical experience in study design, experimental methods, data analysis, scientific communication, and responsible conduct of research while developing an appreciation for interdisciplinary approaches to aging science. In addition to mentored research, UT-MSTAR offers a structured educational curriculum that includes seminars on aging biology, geriatrics, research ethics, biostatistics, grant writing, scientific presentations, and career development. Students also participate in clinical shadowing experiences with geriatricians and clinician-scientists, allowing them to observe the translation of aging research into patient care and better understand the complex medical, functional, and psychosocial needs of older adults. At the conclusion of the program, trainees present their research at the annual UT-MSTAR consortium meeting and are encouraged to present their work at national scientific conferences. The long-term objective of UT-MSTAR is to strengthen the national pipeline of physician-scientists dedicated to aging research by fostering sustained interest in geriatrics, geroscience, and translational research. Through individualized mentorship, multidisciplinary training, clinical exposure, and collaboration across four UT medical schools, the program equips future physicians with the scientific foundation, research skills, and professional networks needed to pursue careers focused on improving the healthspan, independence, and quality of life of older adults.
History of chemical physics – history of the branch of physics that studies chemical processes from the point of view of physics and engineering. History of oenology – history of the science and study of all aspects of wine and winemaking except vine-growing and grape-harvesting, which is a subfield called viticulture. History of spectroscopy – history of the study of the interaction between matter and radiated energy History of surface science – history of the study of physical and chemical phenomena that occur at the interface of two phases, including solid–liquid interfaces, solid–gas interfaces, solid–vacuum interfaces, and liquid–gas interfaces. History of chemicals History of chemical elements - The concept of an "element" as an indivisible substance has developed through three major historical phases: Classical definitions (such as those of the ancient Greeks), chemical definitions, and atomic definitions. History of carbon History of hydrogen Timeline of hydrogen technologies History of oxygen History of chemical products History of aspirin History of cosmetics History of gunpowder History of pharmaceutical drugs History of vitamins History of chemical processes History of manufactured gas History of the Haber process History of the chemical industry History of the petroleum industry History of the pharmaceutical industry History of the periodic table
== S == Paul Sabatier (1854–1941), French chemist, 1912 Nobel Prize in Chemistry corecipient Frederick Sanger (1918–2013), 1958 and 1980 Nobel Prize in Chemistry Carl Wilhelm Scheele (1742–1786), Swedish 18th century chemist, discovered numerous elements Christian Friedrich Schönbein (1799–1868), German-Swiss chemist, invented the fuel cell, and discovered gun cotton and ozone Stuart L. Schreiber (born 1956), American chemist, a pioneer in a field of chemical biology Richard R. Schrock (born 1945), 2005 Nobel Prize in Chemistry Peter Schultz (born 1956), American chemist Glenn T. Seaborg (1912–1999), 1951 Nobel Prize in Chemistry Nils Gabriel Sefström (1787–1845), chemist Francesco Selmi (1817–1881), Italian chemist, regarded as one of the founders of colloid chemistry Nikolay Nikolayevich Semyonov (1896–1986), physicist and chemist, 1956 Nobel Prize in Chemistry T. R. Seshadri (1900–1975), Indian chemist, pioneer in plant chemistry K. Barry Sharpless (born 1941), 2001 Wolf Prize in Chemistry, 2001 Nobel Prize in Chemistry Dan Shechtman (born 1941), 2011 Nobel Prize in Chemistry, discovered quasicrystals Patsy O.
The outermost layer of the gastrointestinal wall consists of several layers of connective tissue and is either of serosa (below the diaphragm) or adventitia above the diaphragm. Regions of the gastrointestinal tract within the peritoneum (called Intraperitoneal) are covered with serosa. This structure consists of connective tissue covered by a simple squamous epithelium, called the mesothelium, which reduces frictional forces during digestive movements. The intraperitoneal regions include most of the stomach, first part of the duodenum, all of the small intestine, caecum and appendix, transverse colon, sigmoid colon and rectum. In these sections of the gut there is clear boundary between the gut and the surrounding tissue. These parts of the tract have a mesentery. Regions of the gastrointestinal tract behind the peritoneum (called retroperitoneal) are covered with adventitia. They blend into the surrounding tissue and are fixed in position (for example, the retroperitoneal section of the duodenum usually passes through the transpyloric plane). The retroperitoneal regions include the oral cavity, esophagus, pylorus of the stomach, distal duodenum, ascending colon, descending colon and anal canal.
== Solvation == Individual surfactant molecules that are in the system but are not part of a micelle are called "monomers". Micelles represent a molecular assembly, in which the individual components are thermodynamically in equilibrium with monomers of the same species in the surrounding medium. In water, the hydrophilic "heads" of surfactant molecules are always in contact with the solvent, regardless of whether the surfactants exist as monomers or as part of a micelle. However, the lipophilic "tails" of surfactant molecules have less contact with water when they are part of a micelle—this being the basis for the energetic drive for micelle formation. In a micelle, the hydrophobic tails of several surfactant molecules assemble into an oil-like core, the most stable form of which having no contact with water. By contrast, surfactant monomers are surrounded by water molecules that create a "cage" or solvation shell connected by hydrogen bonds. This water cage is similar to a clathrate and has an ice-like crystal structure and can be characterized according to the hydrophobic effect. The extent of lipid solubility is determined by the unfavorable entropy contribution due to the ordering of the water structure according to the hydrophobic effect. Micelles composed of ionic surfactants have an electrostatic attraction to the ions that surround them in solution, the latter known as counterions.
Sources: en.wikipedia.org
The Decision of the third plenary session of the 18th Central Committee announced "market forces" would begin to play a "decisive" role in allocating resources. This meant that the state would gradually reduce its involvement in the distribution of capital, and restructure state-owned enterprises (SOEs) to allow further competition, potentially by attracting foreign and private sector players in industries previously highly regulated. This policy aimed to address the bloated state sector that had unduly profited from re-structuring by purchasing assets at below-market prices, assets no longer being used productively. However, by 2017, Xi's promise of economic reforms was said to have stalled by external observers. In 2015, the Chinese stock market bubble popped, which led Xi to use state forces to fix it. China's economy has grown under Xi, more than doubling from CN¥54.8 trillion (US$8.7 trillion) in 2012 to CN¥140.2 trillion (US$20.1 trillion) in 2025, while China's nominal GDP per capita increased from CN¥40,431 (US$6,408) in 2012 to CN¥99,665 (US$14,318) in 2025, surpassing the world average in 2021, though growth has slowed from 7.9% in 2012 to 5% in 2025. Xi has increased state control over the economy, voicing support for SOEs, while also supporting the private sector. CCP control of SOEs has increased, while limited steps towards market liberalization, such as increasing mixed ownership of SOEs were undertaken. Under Xi, an increasing number of private companies have established Party branches.
Ethyl carbamate (also called urethane) is an organic compound with the formula CH3CH2OC(O)NH2. It is an ester of carbamic acid and a white solid. Despite its name, it is not a component of polyurethanes. Because it is a carcinogen, it is rarely used, but naturally forms in low quantities in many types of fermented foods and drinks.
== Medical uses == Cetacaine is a benzocaine-based anesthetic that also contains other active ingredients that include butamben and tetracaine hydrochloride. The main use for this drug is to produce anesthesia to mucous membranes to numb and help control the pain in that area. The spray form of Cetacaine is also used to help prevent gagging in the patient. The anesthetic effect of Cetacaine can be expected to take effect in about 30 seconds and last between 30–60 minutes depending on location and application amount. Cetacaine can and has been used for surgeries that include bronchi, ear, esophagus, larynx, mouth, nose, pharynx, rectal, and vaginal procedures. These procedures can include periodontal treatment, pre-probing, pre-scaling/root planning procedures, pre-injection, and laser dentistry.
== Background == The United States Senate Homeland Security Committee released a report stating that the COVID-19 pandemic had significantly increased scarcity of multiple categories of drugs. Lockdown orders and the necessity of remote working lowered the production and distribution of pharmaceuticals, while decreased trade with China and India for active ingredients further worsened scarcity. In May 2023, the American Cancer Society released a statement alerting healthcare systems to significant shortages in chemotherapy drugs according to several healthcare professionals and patients. It warned that many of the limited drugs were first-line therapies that did not have any alternatives, which at the minimum could cause treatment delays, leading to worse symptoms, prognosis, and health outcomes for patients depending on the medications.
=== Thermodynamic analysis === As SPR biosensors facilitate measurements at different temperatures, thermodynamic analysis can be performed to obtain a better understanding of the studied interaction. By performing measurements at different temperatures, typically between 4 and 40 °C, it is possible to relate association and dissociation rate constants with activation energy and thereby obtain thermodynamic parameters including binding enthalpy, binding entropy, Gibbs free energy and heat capacity.
Sources: en.wikipedia.org
As a chemist he is known best for his work on organic synthesis, including discovery of the aldol reaction Hans-Joachim Born (1909–1987), German radiochemist who participated in the Soviet nuclear weapons programme Carl Bosch (1872–1940), German chemist, pioneer in the field of high-pressure industrial chemistry. Nobel Prize in Chemistry 1931 Octave Leopold Boudouard (1872–1923), French chemist who discovered the Boudouard reaction: combination of carbon and carbon dioxide to form carbon monoxide at high temperatures Jean-Baptiste Boussingault (1802–1887), French chemist with work in agricultural science, petroleum science and metallurgy
It is on the World Health Organization's List of Essential Medicines. The World Health Organization classifies colistin as critically important for human medicine. It is available as a generic medication. It is derived from bacteria of the genus Paenibacillus.
Cathelicidin antimicrobial peptide (CAMP) is an antimicrobial peptide encoded in the human by the CAMP gene. The active form is LL-37, a 37 amino acid peptide having sequence [LL-37, 37 aa] In humans, CAMP encodes the peptide precursor CAP-18 (18 kDa), which is processed by proteinase 3-mediated extracellular cleavage into the active form LL-37. The cathelicidin family includes 30 types of which LL-37 is the only cathelicidin in the human. Cathelicidins are stored in the secretory granules of neutrophils and macrophages and can be released following activation by leukocytes. Cathelicidin peptides are dual-natured molecules called amphiphiles: one end of the molecule is attracted to water and repelled by fats and proteins, and the other end is attracted to fat and proteins and repelled by water. Members of this family react to pathogens by disintegrating, damaging, or puncturing cell membranes. Cathelicidins thus serve a critical role in mammalian innate immune defense against invasive bacterial infection. The cathelicidin family of peptides are classified as antimicrobial peptides (AMPs). The AMP family also includes the defensins. Whilst the defensins share common structural features, cathelicidin-related peptides are highly heterogeneous. Members of the cathelicidin family of antimicrobial polypeptides are characterized by a highly conserved region (cathelin domain) and a highly variable cathelicidin peptide domain. Cathelicidin peptides have been isolated from many different species of mammals, including marsupials.
== List of leaders == The ILEA was formally created in 1964 and began operations in 1965, but the post of Leader did not exist until April 1967. For the period 1964–67, the de facto leadership was shared between the Chairman of the Education Committee, James Young, and the Chairmen of the Authority, Harold Shearman (1964–1965) and Ashley Bramall (1965–1967). From 1967, the Leaders of the ILEA were:
Sources: en.wikipedia.org
Desiccated storage at −20 °C is conventional, with −80 °C for extended periods. Vials should be warmed to room temperature before opening to prevent condensation on the powder.
It usually reports batch-specific results for purity by chromatography, identity by mass spectrometry, and sometimes peptide content and residual solvents. It applies only to the batch tested, not to a supplier's wider stock.
Purity describes the proportion of the chromatographic signal from the target compound, while peptide content measures how much of the vial's physical mass is peptide. Counter-ions, water and residual acid make up the remainder, so content values are commonly lower.
No. TB-500 is a short synthetic peptide matching residues 17 to 23 of thymosin beta-4, while the parent protein contains 43 residues. The fragment lacks the rest of the protein sequence, so the two are related but not identical.